SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9U9G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9U9G8
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.06e-55
Family Variable surface antigen VlsE 0.0000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9U9G8
Sequence length 189
Comment (tr|B9U9G8|B9U9G8_BORBG) Variable large protein {ECO:0000256|RuleBase:RU363105} OX=139 OS=burgdorferi). GN=vlsE OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
EGAIKEVSELLDKLVTAVKTAEEASSGTAAIGEVVADADAAKVADKASVKGIAKGIKEIV
EAAGGSEKLKAVAAAKGENNKGAGKLFGKAGAAAHGDSEAASKAAGAVSAVSGEQILSAI
VTAADAAEQDGKKPEEAKNPIAAAIGDKDGGAEFDHEMKKDDQIAAAIALRGMAKDGKFA
VKDGEKEKA
Download sequence
Identical sequences B9U9G8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]