SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9UAG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9UAG9
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.29e-55
Family Variable surface antigen VlsE 0.0000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9UAG9
Sequence length 194
Comment (tr|B9UAG9|B9UAG9_BORBG) Variable large protein {ECO:0000256|RuleBase:RU363105} OX=139 OS=burgdorferi). GN=vlsE OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
EGAIKEVSELLDKLVKAVKTAEGASSGTDAIGEVVADDNAAKVADKASVTGIAKGIKEIV
EAAGGSEKLKAVAAAEGENNKKAGKLFGKVDAAHAGDSEAASKAAGAVSAVSGEQILSAI
VKAAGAAEQDGEKPGEAKNPIAAAIGKGNADDGADFGQDEMKKDDQIAAAIALRGMAKDG
KFAVKSGGGEKEKA
Download sequence
Identical sequences B9UAG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]