SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9UAZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9UAZ6
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.62e-56
Family Variable surface antigen VlsE 0.0000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9UAZ6
Sequence length 188
Comment (tr|B9UAZ6|B9UAZ6_BORBG) Variable large protein {ECO:0000256|RuleBase:RU363105} OX=139 OS=burgdorferi). GN=vlsE OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
EGAIKEVSELLDKLVKAVKTAEGASSGTAAIGEVVDNDAKAADKASVKGIAKGIKEIVEA
AGGSEKLKAVAAAKGESNKGAGKLFGKAGAGAHGDSEAASKAAGAVSAVSGEQILSAIVK
AADAAEQDGKKPEEAKNPIAAAIGDKDGGADFGKDEMKKDDQIAAAIALRGMAKDGKFAV
KDGEKGKA
Download sequence
Identical sequences B9UAZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]