SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9WAM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9WAM7
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.26e-18
Family Ubiquitin-related 0.00081
Further Details:      
 
Domain Number 2 Region: 288-356
Classification Level Classification E-value
Superfamily XPC-binding domain 1.83e-17
Family XPC-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 139-197
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000484
Family UBA domain 0.001
Further Details:      
 
Domain Number 4 Region: 381-429
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000672
Family UBA domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9WAM7
Sequence length 430
Comment (tr|B9WAM7|B9WAM7_CANDC) UV excision repair protein, putative {ECO:0000313|EMBL:CAX43447.1} KW=Complete proteome OX=573826 OS=3949 / NRRL Y-17841) (Yeast). GN=CD36_16680 OC=Candida/Lodderomyces clade; Candida.
Sequence
MQIVFKDFKKQTVTLDVELTDSVLSTKEKLAQEKGCDSSQIKLVYSGKVLQDDKNLESYK
LKEGASIIFMINKTKKTPTPVPETKSTTESTSQEQVQAQGSTNESTSSSTSSTTTTTAAA
AAAAAGAASTGTTTTSEQQPEQAVSNESTFAVGSEREASIQNIMEMGYERPQVEAALRAA
FNNPHRAVEYLLTGIPESLQHPTPPVPVPAPVPTAPTGQQTERNTSETGQQGANEEHGDG
DEEGEESTQHENLFEAAAAAAAATNQGDSSIGGTTSGVGAGAGAGAGGEGDIGGLGDDQQ
MQLLRAALQSNPELIQPLLEQLAASNPQIASLISQDPEAFVRMFLSGAPGSGNDLGFEFE
DEGAGGAGGATTGGDEEEEEGTIRIQLSEQDNNAINRLCELGFERDIVIQVYLACDKNEE
VAADILFRDM
Download sequence
Identical sequences B9WAM7
XP_002418147.1.45354 573826.CD36_16680 Cd36_16680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]