SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9X9D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9X9D4
Domain Number - Region: 13-113
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0262
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9X9D4
Sequence length 148
Comment (tr|B9X9D4|B9X9D4_9SPIR) Uncharacterized protein {ECO:0000313|EMBL:EEF84015.1} KW=Complete proteome OX=498742 OS=Borreliella spielmanii A14S. GN=BSPA14S_PA0146 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MIMRYKMKILTKNKTYEYPLRVLPVYEWDRVLGFNQSDAIYKLNEVKYLREITSLMISPK
FLDEFYVILDANREFISYYKDYLVAIIYTSQFNTFHIDNDLKKPALVYLSEYENNVGDFV
TFDYIDDNFDYEKVVSSLTSNSNELVAK
Download sequence
Identical sequences B9X9D4
WP_006434236.1.12897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]