SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9Y9B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9Y9B2
Domain Number - Region: 7-110
Classification Level Classification E-value
Superfamily STAT 0.0745
Family STAT 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9Y9B2
Sequence length 112
Comment (tr|B9Y9B2|B9Y9B2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EEF67401.1} KW=Complete proteome; Reference proteome OX=545696 OS=Holdemania filiformis DSM 12042. GN=HOLDEFILI_02417 OC=Erysipelotrichaceae; Holdemania.
Sequence
MAKRKRDMQLNFRVSAEELAVIEQKMSQFGTSNREAYLRKMALDGYVVKLELPELKELVS
LMRRSSNNLNQLTRKVHETGRVYDADLEDISQRQEQLWEGVEEILTQLSELL
Download sequence
Identical sequences B9Y9B2
WP_006059590.1.26330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]