SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0AME7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0AME7
Domain Number - Region: 15-143
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0101
Family Pseudo ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C0AME7
Sequence length 171
Comment (tr|C0AME7|C0AME7_9SPIR) Uncharacterized protein {ECO:0000313|EMBL:EEH01075.1} KW=Complete proteome OX=498741 OS=Borreliella finlandensis. GN=BSV1_0701 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MKIQIIIMLLALLDFPLNARLLDISIEKRADEEIKKYLSYNLILEKEYYTNFPTSEIEKN
IYKLTEHFVKSIMLNKTNYNLLNSNYKEVNKYLIQSELIDKKFLKYKIFKIKNINGIFKS
YSLIYTKKGFYKLELYIENNAEPLKIFNLNITYFFKNLDKISNEMIFFPRE
Download sequence
Identical sequences C0AME7
WP_008882284.1.22230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]