SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0ANM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0ANM8
Domain Number 1 Region: 89-228
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 4.45e-30
Family VanY-like 0.018
Further Details:      
 
Weak hits

Sequence:  C0ANM8
Domain Number - Region: 14-82
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0288
Family Clostridium neurotoxins, "coiled-coil" domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0ANM8
Sequence length 262
Comment (tr|C0ANM8|C0ANM8_9SPIR) Putative carboxypeptidase {ECO:0000313|EMBL:EEH00819.1} KW=Complete proteome OX=498741 OS=Borreliella finlandensis. GN=BSV1_0602 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MKSIYALLFLFINLSLLANNISKKDLEILLKIAQTMNKECKNFIEKNPIQFLKEIKPLVD
AEKNNLLTLINKKIPIPENYKIPDLVNIDDFKDLKNLGAKTIKVRKILIEDLIRLIKDAK
KFGIEIKIKSAYRTQEYQKFLFDYNVKTYGRKVAETQSAIPGHSQHHMGTAIDFINIDDN
LLNTKEGKWLYENSLKYGFSISYPKGFETETGYKAEPWHYLYIGPKPCFIQKKYFNNLQH
KLFEFWNQNKTNLINLIEKYAN
Download sequence
Identical sequences C0ANM8
WP_008882753.1.22230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]