SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0F8D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0F8D3
Domain Number - Region: 192-253
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.0732
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0F8D3
Sequence length 287
Comment (tr|C0F8D3|C0F8D3_9RICK) DNA recombination protein rmuC-like protein {ECO:0000313|EMBL:EEH12522.1} KW=Complete proteome OX=77037 OS=Wolbachia endosymbiont of Muscidifurax uniraptor. GN=WUni_000970 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
KEKLEKFDNEIRELEKERVGAYEGLKEQIGALMNQTSNLANALRKPHIRGKWGEMQLKRV
VEMAGMIEYCDFFTQPSVIDKNEDNLLRPDLIIKMPSGKQIIIDAKVPLDSYMDAISQND
LQIQKEKLKNHSLAIKKHINDLGKKEYWNQFENTPELVVLFLTGEGVFSAALEYEPALIE
IGVEKKVIIATPITLIALLRAIAYGWKQEMIAENAKKISELGHILYERICTMGENFDNLR
RSLKSAVDHYNKTAGSLEARVFPAAREFNKLGIHAKNKSLSAAKELE
Download sequence
Identical sequences C0F8D3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]