SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0NS78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0NS78
Domain Number 1 Region: 81-237
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.000000000000471
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00047
Further Details:      
 
Domain Number 2 Region: 464-574
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000379
Family Pseudo ankyrin repeat 0.041
Further Details:      
 
Weak hits

Sequence:  C0NS78
Domain Number - Region: 561-617
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0017
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0NS78
Sequence length 659
Comment (tr|C0NS78|C0NS78_AJECG) Uncharacterized protein {ECO:0000313|EMBL:EEH05744.1} KW=Complete proteome; Reference proteome OX=447093 OS=2432) (Darling's disease fungus) (Histoplasma capsulatum). GN=HCBG_06008 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MAVDFTLPHALSPQYSQHQAPRDKVTAMPGVALTNGYTGIEIGADTRVHENKNGATVSEV
EVELNNNNGMSSADPPCNKNARKHVLLSTNASFATVAIPFLLKMADVELRVISDDALDFA
QGACYPDTPISAQPGSKLSTRPWMNVTAAELIDWADVLVLGSLGAGTLGAMIAGLTTSLT
LTILRGWDISKRMFLVPGMTISEWQFPMTKRQLSSLATFWPLIKVLPPTLSKFEHPAGLV
EIPWDGWTVFSSEVRNACSSLPSPMQEDNKLANNVCSGTRSTPLVISSNLHERQQETNEE
PNQPGTKSQSTNAICKERPILPPELLTMIFEMLGDWETATSVGVYAKIPVPEQWKPYIPT
ARSPATFEYIVLRGSIKEIEEQLSTIPPRKPLSRIATDLILKFSRTDILDTLCRLRMDLY
LSTPDLKNLPLSASSKFGSTSLLTWWHKSSILPTLPIKDYLPEAIDAASRAGFVDVLEWW
RQSGLPFRYTERSLESASAEGQIAVLDWWKTVSKNAPLGNPVPLKVGKSVLLAAQSGRTD
SLAWWDKSDIPFSHSESVTRIASNHGHVPVLDFWHRRKREKLIFDNQVLVGATKNGHVEV
LEWWKRSGLPVEFKTCDIEEALEDAVSGVEQRVRRWWAQNGLNLGVGTNEWMMVKTLNT
Download sequence
Identical sequences C0NS78
HCBG_06008T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]