SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0QUI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0QUI1
Domain Number - Region: 3-52
Classification Level Classification E-value
Superfamily Stathmin 0.00915
Family Stathmin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C0QUI1
Sequence length 74
Comment (tr|C0QUI1|C0QUI1_PERMH) Uncharacterized protein {ECO:0000313|EMBL:ACO03030.1} KW=Complete proteome; Reference proteome OX=123214 OS=Persephonella marina (strain DSM 14350 / EX-H1). GN=PERMA_0557 OC=Bacteria; Aquificae; Aquificales; Hydrogenothermaceae; Persephonella.
Sequence
MTREEAIQKLLEIDDEFKSWYEEHQELKWKVHKLDKHYPPDPEIEAEEERLKRRKLYLKD
LMETRIREFMSKHQ
Download sequence
Identical sequences C0QUI1
123214.PERMA_0557 WP_012675269.1.53201 gi|225850112|ref|YP_002730346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]