SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0VKA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0VKA3
Domain Number - Region: 33-130
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.0051
Family Taf5 N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C0VKA3
Sequence length 194
Comment (tr|C0VKA3|C0VKA3_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EEH68916.1} KW=Complete proteome OX=525244 OS=Acinetobacter sp. ATCC 27244. GN=HMPREF0023_1572 OC=Moraxellaceae; Acinetobacter.
Sequence
MDKSRLEAISDGVIAIVITVMLIELNIPQGNTFAALQHELHTILSYVLSFIYLGIYWSNH
HHLFQLVKTVNGKIMWVNLHLIFWLTMIPFTTAWSAQSNYAPIPTAAFAFILFMCSLAYD
ILERLIMREQGDNSIARKVLGKDKKLAVSAMLYASSIFLSFIDTRLTLFILILLAMLWFF
PNKHIEDYYSAKQE
Download sequence
Identical sequences C0VKA3
WP_008941019.1.63418 WP_008941019.1.65903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]