SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1BFK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1BFK5
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 4.32e-31
Family Tubulin chaperone cofactor A 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1BFK5
Sequence length 115
Comment (tr|C1BFK5|C1BFK5_ONCMY) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00020059001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MADPRIRQIKIKTGVVKRLVKEKVMYVKETRQQEEKIERLKAEACDEEADSEARYVIKKQ
LEVLQESKMMVPDCHRRLTIAHADLSQILETEEDLAEAEEYKEARTVLDSVKLEG
Download sequence
Identical sequences C1BFK5
NP_001158716.1.32639 XP_020313783.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]