SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1E232 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C1E232
Domain Number - Region: 26-57
Classification Level Classification E-value
Superfamily Orange domain-like 0.0693
Family Hairy Orange domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1E232
Sequence length 249
Comment (tr|C1E232|C1E232_MICCC) Uncharacterized protein {ECO:0000313|EMBL:ACO61849.1} KW=Complete proteome; Reference proteome OX=296587 OS=green alga). GN=MICPUN_93725 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MSQLESYATQTNVQKLSEEEKHKLVAEVMRYMLFSQYRDGAPVTRTKLSEHLSKIAPELK
RAKVSSYIVAEAQVKFNEIFGIEMKELSRKAQKKTGAARTNLQASEPTKEYVLKSLLPSK
IRRQFIDREEDHTFRGFVMAVVALVSVSGGEIEEQVLWKHLARLGVRHDDEAHPKLGNVR
DTLNKLCLQRYLMKEKGVGSDGKDTFRYSLAERAMDELPTEKVDKYVTELMRGHNDEDGN
AAGENGNTT
Download sequence
Identical sequences C1E232
XP_002500591.1.63511 jgi|MicpuN2|93725|estExt_Genewise2Plus.C_Chr_030613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]