SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1G8M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1G8M9
Domain Number 1 Region: 58-215
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.000000000000017
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00051
Further Details:      
 
Domain Number 2 Region: 375-388,442-553
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000353
Family Pseudo ankyrin repeat 0.036
Further Details:      
 
Weak hits

Sequence:  C1G8M9
Domain Number - Region: 539-595
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000902
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1G8M9
Sequence length 636
Comment (tr|C1G8M9|C1G8M9_PARBD) Uncharacterized protein {ECO:0000313|EMBL:EEH47531.1} KW=Complete proteome; Reference proteome OX=502780 OS=Paracoccidioides brasiliensis (strain Pb18). GN=PADG_03615 OC=Paracoccidioides.
Sequence
MPGVVALENRDEDMDTGGDDSHTNGVKNDHVMGRLEVELDRSCWPPSFPFAYNNKLRKRV
LISTTASFANVAILFLMKIPDIELRVISDDVLDLAQITREAACYADTPVPAQPGSKSNSR
SWISVTGAELISWADMLILSPMAAGTLGAMLAGLTTSLTLTVLRGWDITKTVLLVPGMTL
SEWQFPLTKRQLNDLASSWPWVRVLPPILSGYKPPTGLVEIPWDSWAMFGNEVGKCLGYS
SIPISIQEDENLAKNNFSRDGRDLSTDRDKNAQQRNRELSHSKDTEICTNGLAKEKTILP
PEILTMIFEILDDWETATSVGIYTKIPMPRKWKNYIPTSMKPSTIEYAVLRGSMKEIEQH
LSKIPACKPLSILVTDLILKFSRTDILDYLRKSRMDLYLATPQLKNLPLSVSAKFGSTAI
LTWWQNCSALPTLPVKDYLPEAIDAASRAGFVHMLEWWRKSGLPFHYTERSLESASAEGR
IAVLDWWKNTSKTAPPYDPVPLKVGKSVLLAAQTGRTDSLAWWTKSDIPFGHAEAVTRIA
SSHGHVPVLDFWYRQKREKLIFDNQVLVGATKNGHVDVLEWWKRSGLPVEFKTCDIEEAL
EDAVSGVEERVRLWWARNGLNLGVGTNEWMMVKSLN
Download sequence
Identical sequences C1G8M9
PADG_03615T0 XP_010759525.1.95046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]