SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1H4Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1H4Z1
Domain Number 1 Region: 158-273
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 7.32e-39
Family eIF-2-alpha, C-terminal domain 0.0000447
Further Details:      
 
Domain Number 2 Region: 67-152
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 8.24e-30
Family eIF2alpha middle domain-like 0.0000519
Further Details:      
 
Domain Number 3 Region: 5-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000495
Family Cold shock DNA-binding domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1H4Z1
Sequence length 286
Comment (tr|C1H4Z1|C1H4Z1_PARBA) Eukaryotic translation initiation factor 2 subunit alpha {ECO:0000313|EMBL:EEH34785.1} KW=Complete proteome; Reference proteome OX=502779 OS=brasiliensis). GN=PAAG_05832 OC=Paracoccidioides.
Sequence
MSLTNCRFYEEKFPEIDSFVMVNVKQIAEMGAYVKLLEYDNIDGMILLSELSRRRIRSYI
DLSKRRVSPEDVIKCEERYNKSKLVHSIMRHVAEKTKTPMETLYSEIGWPLNKKFGHSID
AFKLSITNPSVWDDVTFPNQVVKDELQSYISKKLTPHPTKVRADVEVTCFSYEGIDAVKD
ALRTAESNNTQDAQVKVKLVSPPLYVLTSHCLDKNHGIAVLEEAIKSISDRIQASDGALV
VKMAPKAVTEHDDAELQALMDKRERENQEVSGDEDMSESDEGIVDM
Download sequence
Identical sequences C1GFX4 C1H4Z1
PABG_05819T0 PAAG_05832T0 PADG_06160T0 XP_002792044.1.40148 XP_010761554.1.95046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]