SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1LGG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C1LGG9
Domain Number - Region: 43-104
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0144
Family Integrin beta tail domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1LGG9
Sequence length 208
Comment (tr|C1LGG9|C1LGG9_SCHJA) Hypotheticial protein {ECO:0000313|EMBL:CAX73797.1} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MYLTFLILKRKYTYYHIKLPLSMIFAIFDKQLISNSIVHVKDVRCTLTDMNIFHKLSSVT
NKCGRIKKRVDEVFERILISDKLRECLLIEDSDCYLTFTEKEREEFLFRLFKHICIGGEI
CQQEDDIKPYIDITRKIYHDLICAHKNPDSGLVEILSHVYEVQVFDDQNNMVFPSNEEHI
NTFAYAIVDPFKRNMIIFYHIFGCGEFF
Download sequence
Identical sequences C1LGG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]