SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1LQR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C1LQR8
Domain Number - Region: 37-128
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.0216
Family Taf5 N-terminal domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1LQR8
Sequence length 143
Comment (tr|C1LQR8|C1LQR8_SCHJA) Major egg antigen (P40) {ECO:0000313|EMBL:CAX77046.1} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MSDLKHEIVSIPVNCEKRTFEEQRRDLLTSLERRNNDNSVELYTDDWSERLSGWIDSSWE
NWNNEIRRLKQGMFVLFPLTTFGLVGTCDPVLLMDQLESQIQDIRNLICANDVPSTGLMK
EYLKDAYEMGEDGKPLRISGITR
Download sequence
Identical sequences C1LQR8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]