SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1MMS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1MMS1
Domain Number 1 Region: 256-337
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000017
Family Pseudo ankyrin repeat 0.019
Further Details:      
 
Domain Number 2 Region: 123-131,171-283
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000235
Family Pseudo ankyrin repeat 0.016
Further Details:      
 
Weak hits

Sequence:  C1MMS1
Domain Number - Region: 98-129
Classification Level Classification E-value
Superfamily F-box domain 0.000185
Family F-box domain 0.014
Further Details:      
 
Domain Number - Region: 390-431
Classification Level Classification E-value
Superfamily beta-Roll 0.0732
Family Serralysin-like metalloprotease, C-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1MMS1
Sequence length 438
Comment (tr|C1MMS1|C1MMS1_MICPC) Predicted protein {ECO:0000313|EMBL:EEH58623.1} KW=Complete proteome; Reference proteome OX=564608 OS=Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga). GN=MICPUCDRAFT_56633 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MSSPKRMKRGVDDDVAGDGSTSPNLDDAPLLERPAADARTRDVVDDDDDDDGRSIDDLRR
ENADLRRANAALEEELRSLREAARSPSLLERFAADANVTEHVLSRLDGGDLAMLALVSRS
MRDVVFTSSVEHDVRDVPAVRRELERMPNFVGSVSRLAWAKERGCPWDARICREAAEGGH
LEVLQWARANGAPWDKWTCAEAASGGHLEVLQWARANGCPWDDWTCIYAAKGGHLEVLQW
ARASDPPCPWDSITCTYAAKGGHLEVLQWARANGAPWDMWTCRKAAKYGHLEVLQWARAN
GAPWDARICHEAAVYGHLEVLQWARANGAPWDMWTCRVASLGGHLEVLQWARANGCPEFD
DDSARANGCPESDPDRISFDSEFLRTHCFSDNDSTDSEDDDDSVDSEDDDDSVDSEDDDD
SVDSEDDDDSVDSSTPGR
Download sequence
Identical sequences C1MMS1
XP_003056978.1.6386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]