SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1MSB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1MSB8
Domain Number 1 Region: 229-327
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000641
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1MSB8
Sequence length 477
Comment (tr|C1MSB8|C1MSB8_MICPC) Predicted protein {ECO:0000313|EMBL:EEH57108.1} KW=Complete proteome; Reference proteome OX=564608 OS=Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga). GN=MICPUCDRAFT_47411 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MPPKKKAKLNPTEPRRPTTPPYEKAAAARPQSAAPLVKFLLDETDAASEIFSRLDPASFA
TSTRACADLFHGFKARARENGKLDQAAFLTTVPRFKWAVENGLLQLGMGLFRHALRMNVK
RAPWQCAFAFGELPASYDYYASWRKAHLESDDAVTILRRLLTDFSGAFDGRSLTREMRED
MSADVAAAGSVDVIKFVATVGNSGWTDEWRDEWGNSIPMMFTYGACAQNAAAEGHLDALK
YLREELSCDWCDGVVLKAAEHGHVEMMLWAINNGCECEESSKYAARAALHGRRNVLEVLR
NLEYPFDELVTADAALGGHLDILKWLRSESFLLETIMETGETWGPCPWDESATANAAGEG
GRDAELLRFARENGCPWDGDVYLRAQEWKRPIAFEWALKNGCPFPTEEDIKRWLSRAEYE
KTPPFHRFAFVKRRDSTGAEMNPKALLDELYSHFAHDGVTTLPDMSHLHDYDPDAEA
Download sequence
Identical sequences C1MSB8
XP_003058653.1.6386 jgi|MicpuC3|193816|estExt_Genemark1.C_5_t20158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]