SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1MYZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1MYZ6
Domain Number 1 Region: 290-299,330-420
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000353
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1MYZ6
Sequence length 615
Comment (tr|C1MYZ6|C1MYZ6_MICPC) Predicted protein {ECO:0000313|EMBL:EEH54520.1} KW=Complete proteome; Reference proteome OX=564608 OS=Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga). GN=MICPUCDRAFT_63247 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MVPLSTPLPCATREGMNDDDDDLGGEASDEIFARRGARLALGTPPRCRKKTRETAAETTA
IILARLPTFVQAHGARARSDRARPVAMSPPPPPTKRRRSGGGERLTLPADLAAELGVEWV
YEDELEARLAIAAEARSVDALLSRDLRDVFVSGVLARLDAADLASFSLASRGCRALADET
RARDAAPPDRASHHEAFLFVVADFAISPARMKLAAALGCPVRDPRTCALVLRGVFERAPR
AFPVDVLEWALGACGNDAWMAAVSRPGIERRPWLWDAAEEEDAMLGSDDDEYFRIEDVKF
LTRVAARVGNLGLVRRLFDAFRLSRRHEETFAGAAEGGHVFIIEHLLTERDAFIPVDRVF
ELAAGRGRVELLRFLLDNGMRPETPRSRARCARAAADAGEIDCVEWLFANGFEMDEATKD
TMRAIGNSIAQTGRPPLAPDDIEDIAHRRHEAWLAEGRPIPIRSGGGGAPANAQPWRDER
GPRGWQLSSGEGGVARDIDDYDFGLDFETTKDVVVDEGPPAGFEAPPEPFSDVDSDSDGD
DPEFPPGFEPKAAVESGGGPLDPRLLRPKKGCSASGPLDVEPAPADAGGARSDRREAVED
MTDDQVLAYLRSLQE
Download sequence
Identical sequences C1MYZ6
XP_003060870.1.6386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]