SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1MZM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C1MZM3
Domain Number - Region: 270-278
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0275
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1MZM3
Sequence length 292
Comment (tr|C1MZM3|C1MZM3_MICPC) Predicted protein {ECO:0000313|EMBL:EEH54895.1} KW=Complete proteome; Reference proteome OX=564608 OS=Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga). GN=MICPUCDRAFT_60782 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MKLPRLDENTPLAPQEASPSTSRSIARAATRVVAAIAVLAAFAAAVVSTRGGDFDFNLAG
ALPSLGAQGASPPRFLTKRHLRHAIEHCMKLGDLSHKCKSMRDWDVSFITDMSGVFAGFA
DYNPDVSNWNTAQVTSTAGMFSGASGFDGDLGAWDMRGVVDMSGMFRGATAFTGRGLERW
DVGGVKDATMTFRGAKSFVADISQWNVANVVHMDGMFEQATAFDVDLNPPMSMWDACKAT
REKMFEGATKMEADASKQPRESQPGCGVSPPPPPPPPPTEGDQDEDEDQEDR
Download sequence
Identical sequences C1MZM3
XP_003061245.1.6386 jgi|MicpuC3|60782|MicpuC2.EuGene.0000090333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]