SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1N3M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1N3M4
Domain Number 1 Region: 135-187
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000131
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1N3M4
Sequence length 237
Comment (tr|C1N3M4|C1N3M4_MICPC) Predicted protein {ECO:0000313|EMBL:EEH53217.1} KW=Complete proteome; Reference proteome OX=564608 OS=Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga). GN=MICPUCDRAFT_52228 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MGACATKCFARDPPLRSSYPPTRSAEDEYRVAMLVLPLVEDVKTRVVASRLSRGWRDADK
SAASLPAKLDGLDLYPNNPRNTYGRVVTASYEYVMRHEGVLDLPKERVEALLTRFWETPP
THRLFKDTHYFCQRAAYIGNLELLQWLREHDYPWSTATCASAVFGSQLEVLRWALANGAP
WDKYETTFSRPGNRENVITWLLNPRKGDPRPSDWEKYLELLREAGKRQVSKRLVARG
Download sequence
Identical sequences C1N3M4
XP_003062398.1.6386 jgi|MicpuC3|52228|MicpuC2.EuGene.0000120293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]