SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1NAJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1NAJ3
Domain Number 1 Region: 69-115
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000157
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1NAJ3
Sequence length 220
Comment (tr|C1NAJ3|C1NAJ3_MICPC) Predicted protein {ECO:0000313|EMBL:EEH50899.1} KW=Complete proteome; Reference proteome OX=564608 OS=Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga). GN=MICPUCDRAFT_54935 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MNFISLGRGDGDRRSRRREVHTSVVFRCNPFLTRVEDLRASRTSFPASHTAVVFRAVPYD
FLVMYNLHFFKIAAERGHLEMLQWARANGAPWDERTCAKAARGGHLEMLQWAKAMGCPCE
GYGLCLLPPSDTPGFASPLSAPSLLSSLPTCVPRSVPARHSAPPPHLRASREATRQPPWP
AICATPFRARRSSYPCAPDWSVRESSHHVWARGYEVSTYT
Download sequence
Identical sequences C1NAJ3
XP_003064919.1.6386 jgi|MicpuC3|54935|MicpuC2.EuGene.0000190115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]