SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2BG51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C2BG51
Domain Number - Region: 93-129
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.00379
Family Rabenosyn-5 Rab-binding domain-like 0.011
Further Details:      
 
Domain Number - Region: 51-107
Classification Level Classification E-value
Superfamily Poly(A) polymerase catalytic subunit-like 0.00902
Family Poxvirus poly(A) polymerase catalytic subunit-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C2BG51
Sequence length 134
Comment (tr|C2BG51|C2BG51_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EEI86166.1} KW=Complete proteome; Reference proteome OX=525254 OS=Anaerococcus lactolyticus ATCC 51172. GN=HMPREF0072_1321 OC=Anaerococcus.
Sequence
MLINVPLLKIADEYEEEGFQIIGDFHDLFILGEDGGLHYLNIQGMVGTRYKELKFKTQYS
DIWGEELFEKANFLGLMDLDAKRFRADKDPRYLEIRKAIENYFKEIEEAAKKEEAEMLEE
LIGEIEERKGKENG
Download sequence
Identical sequences C2BG51
WP_004829142.1.41671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]