SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2E323 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2E323
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000941
Family Nucleotide and nucleoside kinases 0.041
Further Details:      
 
Weak hits

Sequence:  C2E323
Domain Number - Region: 186-246
Classification Level Classification E-value
Superfamily Hypothetical protein MG354 0.0301
Family Hypothetical protein MG354 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C2E323
Sequence length 311
Comment (tr|C2E323|C2E323_LACJH) Uncharacterized protein {ECO:0000313|EMBL:EEJ60733.1} KW=Complete proteome OX=525330 OS=Lactobacillus johnsonii ATCC 33200. GN=FC22_GL001240 OC=Lactobacillus.
Sequence
MRKIFLLRGAPGSGKSSFIARHHLQPYAISRDEIRLLLADLTVYYEESTDHLHQVIPRHV
TVRTEQMVDNLVQHKMAYGETIIVDGTHITPDKIEHFRPWVEKYRYELFVVDLMQNNTLE
SLLQRNQVRMHYDWVKPDVIKMMYEQYKAHPEVPSWAYSILPNGMERALSQKEKNLDQYS
HVICVPDKVRPEDFPHVHISNFYFSFNDEFTKKYGTYRNVITLGKTREEVIEKFRLPYFV
FKFHHKHFLISAYPIRNEMLDPIRKVKGVWSYSTGLYNIADFVKEFPENEHQHVHQFNLS
KIDPTRLLHIW
Download sequence
Identical sequences C2E323
WP_004895804.1.2199 WP_004895804.1.48560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]