SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2E753 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2E753
Domain Number 1 Region: 2-330
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.2e-79
Family Mycolic acid cyclopropane synthase 0.0000256
Further Details:      
 
Weak hits

Sequence:  C2E753
Domain Number - Region: 355-378
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0445
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C2E753
Sequence length 392
Comment (tr|C2E753|C2E753_LACJH) Cyclopropane-fatty-acyl-phospholipid synthase {ECO:0000313|EMBL:EEJ59328.1} KW=Complete proteome OX=525330 OS=Lactobacillus johnsonii ATCC 33200. GN=HMPREF0528_1577 OC=Lactobacillus.
Sequence
MLEKPLYKMMLSHSFNIPVKVTYWDGKSEIYGNGTPEVEVIFNKKIPFKEITSNASLALG
EAYMDKDLEIKGSIQKLIEAAYESSESFMRASKFRKFLPKQKHTEKQSQEDVQSHYDIGN
DFYKLWLDPTMTYSCAYFTNGNKEDLEAAQIAKVHHILQKLDSKPGKTLLDIGCGWGTLM
LTAAKEYGLKVTGVTLSQEQFDLVNQKIKDMGLENQAEVLLEDYRELGNRDFDYVTSVGM
FEHVGSENLGEYFKDVAKYLKPHGVALIHGITRQQGGATNAWINKYIFPGGYIPGLVEIV
SRIEEANLQIADMEMLRRHYQRTLEIWDKNFNDHRSEVEGMMGERFVRMWDMYLQACAAS
FESGNIDVIQYLLTKGPSGKTLPMTRQYMLND
Download sequence
Identical sequences C2E753
WP_004895273.1.48560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]