SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2FV67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2FV67
Domain Number 1 Region: 104-395
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.68e-40
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  C2FV67
Domain Number - Region: 3-72
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0811
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C2FV67
Sequence length 398
Comment (tr|C2FV67|C2FV67_9SPHI) Ankyrin repeat protein {ECO:0000313|EMBL:EEI93190.1} KW=Complete proteome OX=525372 OS=Sphingobacterium spiritivorum ATCC 33300. GN=HMPREF0765_1223 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MTNEELTALEKASNNGDDKLISDLLTLLDGKKNFDDYKLKSSIRQFIQKENYQILNALID
KGLIETDLYEYDRFSGSVIELLIHPGITDQQALSAYLDWLPQLFNKIDDIDEEVSGVTLL
QYALGIGAPLGSLQILVACGADIHQKDKYDQSLLYHACSVSPVNVKNAPEIVGWLLDNGV
EVDAANVENRTPLCRAVSTGNISLLSLLLENGADPSVQDWKGENAFYHAAVHLHNKDMVK
LLLQYQTPDWHMLTKQNENLLNAFLRAMLNGNEDDLEILELFFENGADPEMTSQYYSAEK
SGLDWIAEKPFEIMERLLEKQYFRIDYQDNEGNTLLHKVCRFNVNYEEKAAKDLYRKVKL
LLKAGADPNIENTADKKAVDYAMEDNLKTKTVELLLNQ
Download sequence
Identical sequences C2FV67
WP_003006850.1.49144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]