SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2PYQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C2PYQ6
Domain Number - Region: 437-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0183
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C2PYQ6
Sequence length 488
Comment (tr|C2PYQ6|C2PYQ6_BACCE) UPF0061 protein bcere0007_32000 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=526972 OS=Bacillus cereus AH621. GN=bcere0007_32000 OC=Bacillus cereus group.
Sequence
MTKNNEAGWNLDNSYTTLPQSFYTEIPPTPVHSPELIKLNNSLAISLGFNPEELKKDAEI
AILAGNTIPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGERFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVSTGEPIYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLKALADYTIKRHYPEVESTENPYVALLQEVIKRQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDSYNQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEAALKIAQDEISKFSVQYENNWFLGMKKKLGLFSNEEQDQSLIE
KLLKAMEKYKADYTNTFRALTDTTLENAPLFESPEFKEWYELWQSRLERQKESQDDAYKL
MKNNNPVIIPRNHRVEEALEAAVKNGDYSVMEKLLQALANPYEYSQEQADYCTPPAPTNR
PYRTFCGT
Download sequence
Identical sequences C2PYQ6 J8IE23
WP_002014179.1.28299 WP_002014179.1.79293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]