SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2SN30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C2SN30
Domain Number - Region: 349-462
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0301
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C2SN30
Sequence length 488
Comment (tr|C2SN30|C2SN30_BACCE) UPF0061 protein bcere0014_32440 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=526976 OS=Bacillus cereus BDRD-ST196. GN=bcere0014_32440 OC=Bacillus cereus group.
Sequence
MTKNNEAGWNLDNSYTTLPQSFYTEIPPTPVHSPELIKLNNSLAISLGFNPEELKKDAEI
AILAGNTIPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGERFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVSTGEPIYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLKALADYTIKRHYPEVESTENPYVALLQEVIKRQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDSYNQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENNWFLGTKKKLGLFSNEEQDQSLIE
KLLKAMEKYKADYTNTFRALTDNILENAPLFESPEFKEWYELWQSRLERQKESKDDAYKL
MKNNNPVIIPRNHRVEEALEAAVKDGDYSVMEKLLQALANPYEYSQEQADYCTPPVPSNR
PYRTFCGT
Download sequence
Identical sequences A0A0A0WI51 C2SN30 R8MV42
WP_002033415.1.30061 WP_002033415.1.4496 WP_002033415.1.57105 WP_002033415.1.60236 WP_002033415.1.86789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]