SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2VWL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C2VWL8
Domain Number - Region: 437-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.017
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C2VWL8
Sequence length 488
Comment (tr|C2VWL8|C2VWL8_BACCE) UPF0061 protein bcere0021_32440 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=526985 OS=Bacillus cereus Rock3-42. GN=bcere0021_32440 OC=Bacillus cereus group.
Sequence
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEI
AIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYENQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENQWFLGMKKKLGLFSNEEQDQSLIE
QLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERPEESKENAYEM
MKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYSTDQEKYCVPPVPTNR
PYRTFCGT
Download sequence
Identical sequences C2VWL8
WP_000164882.1.49831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]