SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2WWG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2WWG0
Domain Number 1 Region: 120-424
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.57e-53
Family MoCo biosynthesis proteins 0.0042
Further Details:      
 
Weak hits

Sequence:  C2WWG0
Domain Number - Region: 42-135
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000392
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C2WWG0
Sequence length 462
Comment (tr|C2WWG0|C2WWG0_BACCE) Antilisterial bacteriocin (Subtilosin) production {ECO:0000313|EMBL:EEL52973.1} KW=Complete proteome OX=526987 OS=Bacillus cereus Rock4-2. GN=bcere0023_54640 OC=Bacillus cereus group.
Sequence
MIKVNGYLFWKEKLEIRKFTSNYESMLVVHKNPNESAPTLKNENTFTINKTATEIIELID
GTKTYGQVVSFLSLKYSEDPISIEKKLNAFLNNVSKVYNMNIGTQEEPINVPVNLIEEQT
IYPKVASIEITNRCNVRCRHCYGDFGAVKPKVMSLDQIKSLLDDLNNIGVKLIELTGGDI
TVHPNLKEILLYALNLDFSQITLLTNGIALSDKVMDIIIKNKSKTFVQIDMHSLDDNYLT
WFFKVPNTLHKIKNNIMKLAENDVRLRIATIVTHLNVHEVEDIAEWVHNLGIDSIGVSPV
IPMGRALGCSDLYLNEEDVKTYGEALLKINKKYPKFVSLYEGARAEIRNCGAITSHIVIA
PDGEIKMCTMHSLDDLKNSIGNVFEQNIKDIYDEKFKYINAFFNLQAPQMDSEECKECEN
KRFCSTCFLRSFIKAQEIGDKCKWFKNHVPEIIKEPLMVGQN
Download sequence
Identical sequences A0A243DB11 A0A2C1P7G9 C2WWG0
WP_002197114.1.101224 WP_002197114.1.10584 WP_002197114.1.24795 WP_002197114.1.47437 WP_002197114.1.86374 WP_002197114.1.87947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]