SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2XKV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2XKV4
Domain Number 1 Region: 7-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000482
Family Tetracyclin repressor-like, N-terminal domain 0.0079
Further Details:      
 
Weak hits

Sequence:  C2XKV4
Domain Number - Region: 63-135
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00301
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C2XKV4
Sequence length 206
Comment (tr|C2XKV4|C2XKV4_BACCE) Transcriptional regulator, TetR {ECO:0000313|EMBL:EEL61902.1} KW=Complete proteome OX=526989 OS=Bacillus cereus F65185. GN=bcere0025_53950 OC=Bacillus cereus group.
Sequence
MPKQTFFNLASEKKEALIQAAMKEFSRVPLFEASISNIIKDAGIPRGSFYQYFEDKEDVF
FFILDEYSKKDNEKIISILKEKDGDLFEAYIELYQYMLTKFQNLENRNFFRNAFLNMNYK
VENTLTRNVNEENYKSRLSEIMVLINTEKLNIIEEGEIFHIMKIIMMVTFQNLIQSFAKE
IPFDESVKNYALELSLLKKGFYKGGE
Download sequence
Identical sequences C2XKV4
WP_001126046.1.55077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]