SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3GLW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C3GLW2
Domain Number - Region: 362-379,437-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00837
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3GLW2
Sequence length 488
Comment (tr|C3GLW2|C3GLW2_BACTU) UPF0061 protein bthur0010_32470 {ECO:0000256|HAMAP-Rule:MF_00692} KW=Complete proteome OX=527029 OS=Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1. GN=bthur0010_32470 OC=Bacillus cereus group.
Sequence
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEI
AIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENNWFLGMKKKLGLFSNEEQDHSLIE
QLLKMMEKYKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLEKQEESKENAYEM
MKNNNPSIIPRNHRVEEALEAAVTNGNYSVMEKLLEALANPYAYSTDQEEYCVPPVPTNR
PYRTFCGT
Download sequence
Identical sequences A0A0B5NM26 C3GLW2
WP_000164884.1.100059 WP_000164884.1.23615 WP_000164884.1.42217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]