SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3H2A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3H2A9
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000211
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.025
Further Details:      
 
Weak hits

Sequence:  C3H2A9
Domain Number - Region: 76-129
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0863
Family Staphylocoagulase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3H2A9
Sequence length 233
Comment (tr|C3H2A9|C3H2A9_BACTU) Nucleotidyltransferase {ECO:0000313|EMBL:EEM83430.1} KW=Complete proteome OX=527030 OS=Bacillus thuringiensis serovar huazhongensis BGSC 4BD1. GN=bthur0011_25940 OC=Bacillus cereus group.
Sequence
MKPIEAAQNIITSQFPNCDVALLGGSVARGEATKTSDLDIVIVDHSLTSCYRESFYSNGW
PVEVFVHNFETYKTFFKMDCDRGRPSLPQLVSEGIALKGEQEIVEKLKKEANDLLHKGPA
KWTEETIKQKRYFITDTLDDFIGATKREEELFIANLLADLVHEYVLRVNGMWLGSSKWFI
RVLRRYDEQYANKFVAAFDYFYKTGEKNELIHFIEKTLEQYGGRVFEGFSIGK
Download sequence
Identical sequences C3H2A9
WP_000802426.1.87873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]