SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3KHM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3KHM5
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 4.45e-33
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3KHM5
Sequence length 110
Comment (tr|C3KHM5|C3KHM5_ANOFI) Signal recognition particle 14 kDa protein {ECO:0000313|EMBL:ACQ58147.1} OX=229290 OS=Anoplopoma fimbria (Sablefish). GN=SRP14 OC=Anoplopoma.
Sequence
MVLLENDAFLTELTRLFQKCRTSGSVVITLKKYDGRTKPAPRKGHAESFEPADNKCLIRA
SEGKKKISTVVSTKEVIKFQMAYSNLLRAHMDGLKKKDKKSKSKKTKATQ
Download sequence
Identical sequences C3KHM5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]