SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3MZ09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3MZ09
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 1.17e-44
Family RNA polymerase subunit RPB10 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3MZ09
Sequence length 66
Comment (sp|C3MZ09|RPON_SULIM) DNA-directed RNA polymerase subunit N {ECO:0000255|HAMAP-Rule:MF_00250} KW=Complete proteome OX=427317 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1). GN=M1425_2052; OC=Sulfolobus.
Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVI
HYTRPI
Download sequence
Identical sequences B8YB63 C3MJQ1 C3MZ09 C3N058 C3N8S2 C3NMP6 C4KJ97 D2PED0 F0NIQ6 F0NL07 M9UGL2
gi|227828311|ref|YP_002830091.1| gi|227831069|ref|YP_002832849.1| gi|238620503|ref|YP_002915329.1| gi|229579950|ref|YP_002838349.1| 419942.YN1551_0741 426118.M164_2059 427317.M1425_2052 427318.M1627_2132 429572.LS215_2217 439386.YG5714_2178 WP_012712019.1.100559 WP_012712019.1.13477 WP_012712019.1.27011 WP_012712019.1.27461 WP_012712019.1.34992 WP_012712019.1.44962 WP_012712019.1.47130 WP_012712019.1.48461 WP_012712019.1.52267 WP_012712019.1.60638 WP_012712019.1.66823 WP_012712019.1.67233 WP_012712019.1.68242 WP_012712019.1.74483 WP_012712019.1.83431 WP_012712019.1.84481 WP_012712019.1.89621 WP_012712019.1.90709 WP_012712019.1.91160 WP_012712019.1.97021 gi|284998565|ref|YP_003420333.1| gi|385776633|ref|YP_005649201.1| gi|229581389|ref|YP_002839788.1| gi|479326300|ref|YP_007866355.1| gi|229585541|ref|YP_002844043.1| 2waq_N 2wb1_N 2wb1_O 2y0s_N 2y0s_O 4ayb_N 4v8s_AO 4v8s_BN gi|385773991|ref|YP_005646558.1| cath|current|2waqN00/1-64 cath|current|2wb1N00/1-64 cath|current|2wb1O00/1-64 cath|current|2y0sN00/1-64 cath|current|2y0sO00/1-64 cath|current|4aybN00/1-65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]