SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3YKK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3YKK9
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.65e-34
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3YKK9
Sequence length 123
Comment (tr|C3YKK9|C3YKK9_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN59077.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_63302 OC=Branchiostoma.
Sequence
MSAPCGHRPAYTTAGFPAGLKVKFPCLQCPKLFVKPSTKSNRHIIINALKDCCLAGEVNN
QVKGKVLEALAMSESFHYVILFRDARCQFRAVYSYNPENEKIHKLVGNGPSSIQGKMINS
LYK
Download sequence
Identical sequences C3YKK9
7739.JGI63302 XP_002603065.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]