SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3ZG54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3ZG54
Domain Number 1 Region: 268-470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-31
Family Nucleotide and nucleoside kinases 0.00024
Further Details:      
 
Domain Number 2 Region: 60-178,208-257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-19
Family Nucleotide and nucleoside kinases 0.00061
Further Details:      
 
Domain Number 3 Region: 392-420
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000196
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.002
Further Details:      
 
Domain Number 4 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00000131
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0024
Further Details:      
 
Domain Number 5 Region: 13-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000144
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3ZG54
Sequence length 481
Comment (tr|C3ZG54|C3ZG54_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN48529.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_118931 OC=Branchiostoma.
Sequence
MDETKKPLRIPPEFGTYAEKHGIFDLYKRVIENIVIDKPEEPLQYIIDYLKRENDDVPQI
CILGPPAAGKRTIAREVCKRLRVVHITPEALVGDDVNPVAKQARNIVKAGESIPVEVWVS
LVKNRIKSHDCIKKGWLLEGFPQTRDQAQAIQAEGISPKHCVVLEAPDTVLIERVAGKRV
DPQTGDVYHTTFDWPSNSEIESRLIVPEGITEESMVNSLVEYHRHTADVLRCFPKVTKKI
NADQPKADILALVLTFLNSTPRTAAPHTPRIVLLGPTGAGKSVQASLIANKYNITNLSCG
ALIKEAIADETKIGEAIKPYVERGMMVPDNLVMKVLSDRLSRLDAVSRGWVMHGFPRTRE
QAESLKDANLDPNRVFFLDIPNDSVMERLVLRRTDPVTGERYHFLYNPPRTNEVKARLHQ
HPKDEEEAVKKRLIEYHAYAEEIADFYEAAMRINADQDPHTVFEFIESMIVNPLPKKHGD
D
Download sequence
Identical sequences C3ZG54
7739.JGI118931 XP_002592518.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]