SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3ZMF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C3ZMF6
Domain Number - Region: 120-162
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0196
Family MukF C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3ZMF6
Sequence length 203
Comment (tr|C3ZMF6|C3ZMF6_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN46412.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_121418 OC=Branchiostoma.
Sequence
MSPSHIEILRQEINNLCERIANIPRRMESIISSANEAARTSERFLVACRDSVNSARSLNS
ETVAHLARLRESTTDHSPGWFGVGLVVCAAVLTGGIALLLLAALAAAIDLLSSLAVVRVS
SSFGEQIGNLDDHQRNMGEKVRELEREWLNRIHTCVTMMERDTTVKHKLFNKERKVIVPS
LASIQSDFDNIFENLDLLQSVQL
Download sequence
Identical sequences C3ZMF6
7739.JGI121418 XP_002590401.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]