SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4JGC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4JGC8
Domain Number 1 Region: 23-181
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.53e-20
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00043
Further Details:      
 
Domain Number 2 Region: 400-511
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000759
Family Pseudo ankyrin repeat 0.026
Further Details:      
 
Weak hits

Sequence:  C4JGC8
Domain Number - Region: 497-553
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00103
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4JGC8
Sequence length 593
Comment (tr|C4JGC8|C4JGC8_UNCRE) Uncharacterized protein {ECO:0000313|EMBL:EEP76270.1} KW=Complete proteome; Reference proteome OX=336963 OS=Uncinocarpus reesii (strain UAMH 1704). GN=UREG_01119 OC=Eurotiomycetidae; Onygenales; Onygenaceae; Uncinocarpus.
Sequence
MKAGQMRLLNSPSRHHNRVLLSTSTPFSDTVMRSLLRDPDIELRLIADRDLDDTVCSVEN
LLYYPDVPQAETYRNRREWMNITAASLADWADVFIVAPADAGTLGAMVSGLTSSLTLTIL
RGWDVSKTILLVPKMMQLEWKSPITGRQLDEIRTFWPWAKILPPVLSRFEPPETLVEMPW
EGREMFYEEIRKGLGWPFNVSGIEGSIGIGNGAVMPGIIDTQSCDVGQSTPEIPDDRSES
TTLRNSTPGRDPHGPVLPPELLTMVFEALNDWETAAAVGVYSKIPMPEHWKPFVPKSDCP
TAPVSLEHTILRKPLHEITQLISAAPPWKPLSNLAAHLIFKFSRTDILDYICQSRIDLYW
STPRLSSLPLRVSAVYGNTALLEWWRNCPELPTNDYLPDALDGASRAGFVHVLEWWRNSG
LPLRYSERALESASAEGHIAVLDWWKRASEASAYFDPVPLKIGKSVLLAAQSGKTASLVW
WDESGIPYSHGESVARIASTHGHVPVLELWYRLKGSKIIFDNQVLVGATKNGHVDVLEWW
RRSGLRVEFKTCDIEEALEDAVSGAEERVRRWWERNGLNLGVGTSEWMEVKVL
Download sequence
Identical sequences C4JGC8
URET_01119 XP_002541603.1.76999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]