SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4R2M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4R2M8
Domain Number - Region: 23-101,202-285
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00144
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4R2M8
Sequence length 559
Comment (tr|C4R2M8|C4R2M8_KOMPG) Uncharacterized protein {ECO:0000313|EMBL:CAY69752.1} KW=Complete proteome; Reference proteome OX=644223 OS=pastoris). GN=PAS_chr2-2_0171 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
Sequence
MNKKWILRGFIPIRRYSNTLGNLTDQVSKIKYLTIDSALQSMLKEYHQKFKSIRKSNTTP
FWIFEKKGNDTNSFFEKYYEQYINKKMGRGSYQDIVTKRAKIAKHDAPVHVYCEFLKELY
PANGNNVDHYALYSKYMQLPSPRLTYIQNVDLEKFLSEFFMNQRGRIKGKGLSVMSKILR
DVQACHVPLSGKEINMFITTRYFDEEFTLKDYETLSRLYGNYLQVDSYNIMIRYSIKYRN
YDLVEQLLEAMAGKGLNPDRITYALLFKYYSVTNDKNRVEFLLSQMLNDGIVIDINLVNQ
LIGAYIRMNMIKEAEALFNFLVECSNRLRLLGGEVTHLNTDISRRQYRKKAKLLDYITKE
LKVSGSTVNDSPFLFYLNPTEDTALQFFKLYRSWIEEMNYQAAITAINDIYNMFDYQMKV
VEDNKIPLSNKLLVELLLCYLNVAQSGVSCNWTLGTFRRVLYLIINSKKKSLKLEQHIDQ
NFIKLIDLMDLILQVFEAFGTLSVERERARQLKIKKVTQGLNYGRWEDNKVLTMIEKELL
DILEDLLKKSFKLDPQEGD
Download sequence
Identical sequences C4R2M8 F2QR47
644223.PAS_chr2-2_0171 XP_002492032.1.19831 gi|254569844|ref|XP_002492032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]