SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4V1Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4V1Z5
Domain Number - Region: 185-221
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00837
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4V1Z5
Sequence length 363
Comment (tr|C4V1Z5|C4V1Z5_9FIRM) HNH endonuclease domain protein {ECO:0000313|EMBL:EEQ49126.1} KW=Complete proteome OX=638302 OS=Selenomonas flueggei ATCC 43531. GN=HMPREF0908_0442 OC=Selenomonadaceae; Selenomonas.
Sequence
MKIELQKIPVRAVVEGYLDSAENGVVGYGGKLNIRPAFQREFIYKDKQRDEVIHTIKKNF
PLNVMYWVKSGGEHFELLDGQQRTISICQYVHGDFSIEHRAFHNLTAEEKQQILDYPLMV
YICEGTDREKLDWFKIINIAGEQLTAQELRNAIYTGEWLAEAKKRFSKPLCPAHQLAKDY
LSGSAIRQNYLETALRWIAARDDIEIEDYMAQHQHDTNCSDLWLYFKGVVDWVQVTFPQY
RKEMKGLEWGILYNRYKDGKYDPKTLEARVAALMEDDDVTKKSGVYEYVLGGAEKCLSIR
AFSSSMSRAAYQRQKGICPKCGKQFQIEEMQADHITPWSKGGKTTPENCQMLCAPCNRRK
SNV
Download sequence
Identical sequences C4V1Z5
WP_006690706.1.36224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]