SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4VA50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4VA50
Domain Number - Region: 50-65,121-154
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0183
Family Pseudo ankyrin repeat 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4VA50
Sequence length 167
Comment (tr|C4VA50|C4VA50_NOSCE) Uncharacterized protein {ECO:0000313|EMBL:EEQ81902.1} KW=Complete proteome; Reference proteome OX=578460 OS=Nosema ceranae (strain BRL01) (Microsporidian parasite). GN=NCER_101488 OC=Eukaryota; Fungi; Microsporidia; Nosematidae; Nosema.
Sequence
MIFENGSKYVGEQLSIDNSFCIEMKIDNINYVEEVLCGTFKIYNSDKTYIKLSTYFEALI
IGNLHPFYTEETGEDKEYWKRLPGYSDSYSFKYSNYIYLKMKELFILPDASYNTSDASID
GCYYCCYCKNLDCFIGHYLYKNENRNLSQEILLERINERTKGVACFV
Download sequence
Identical sequences A0A0F9WCB0 C4VA50
XP_002995573.1.67189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]