SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4WB08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4WB08
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily BH3703-like 4.18e-52
Family BH3703-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4WB08
Sequence length 163
Comment (tr|C4WB08|C4WB08_STAWA) Uncharacterized protein {ECO:0000313|EMBL:EEQ79775.1} KW=Complete proteome OX=596319 OS=Staphylococcus warneri L37603. GN=STAWA0001_0482 OC=Staphylococcus.
Sequence
MNFEDKLDNIYQEIANNANQIIPDEWKNIFMESEVTEDGGSVYFFYTLKKEEGFFYSHDI
PIKFNVSKRIYKDILNELYECFKELRKEFIKNNQEVWTTCTFILNDEGKANISFGYINWL
DNDFTLGTRIDYFKYKYFGELPEQQRLIDEVKQLEQFIKEQEE
Download sequence
Identical sequences C4WB08
WP_002451406.1.32516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]