SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4WW45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4WW45
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000051
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4WW45
Sequence length 163
Comment (tr|C4WW45|C4WW45_ACYPI) ACYPI009371 protein {ECO:0000313|EMBL:BAH72115.1} OX=7029 OS=Acyrthosiphon pisum (Pea aphid). GN=ACYPI009371 OC=Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
Sequence
MANERTYVVPSLLQTAAANACTEIERGRFDFLEVPDVDMRHCCDSLLEILKIEKNRNEGN
EGQTMFIRLQLTSKDKRFLNICEEAASHGHINCLKLAHEIGVPWNDKACKRAASSGHLEC
LRYARENGCPWNEKTCSYAALNGHMDCLIYARENGCPGNPTRT
Download sequence
Identical sequences C4WW45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]