SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YCV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4YCV6
Domain Number - Region: 141-185
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.033
Family Outer membrane lipoprotein 0.0086
Further Details:      
 
Domain Number - Region: 77-110
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0471
Family Cna protein B-type domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YCV6
Sequence length 218
Comment (tr|C4YCV6|C4YCV6_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ42142.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_00340 OC=Candida/Lodderomyces clade; Candida.
Sequence
MFSLSSSKCVAILVMLLQLSNALHFYVKTGETKCFYEELPENTLVVGKIDAYEKQDHSNE
YFKNPNLKVQIIVEETFDNNHKVANQKSAPDGDFAFTSLDSGEHRFCLTPVYSDNTNNKV
HRIFFDVAQGSANEYVDSKSTRMVDDLTGKVNQLYDKLDKIHWEQEHMREREATFRDQSE
STNSRVVKWSIVQLIVLVGTCVYQLRHLKSFFVKQKIV
Download sequence
Identical sequences C4YCV6
CAWT_00340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]