SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YG41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YG41
Domain Number 1 Region: 55-88,140-372,399-453,642-674
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.04e-40
Family WD40-repeat 0.00078
Further Details:      
 
Weak hits

Sequence:  C4YG41
Domain Number - Region: 1133-1190
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0868
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4YG41
Sequence length 1210
Comment (tr|C4YG41|C4YG41_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ41965.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_00159 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSRINNNNDKSSILSNITTTNTTTGTGTTNTTTVPSIKTKRGLSYILGDSNSNENHILPI
NSIQYSSSNRQLYTAGRDGNVKVWQPHSIQPYSNQHSGNNSQDDLFSDCLDLDEKLLRLE
TSISSNPLSYNYNGNTSSNFNIVENYNLHFDWINDMQLVNNDQNLITCSSDLSIKIIDLP
TQHVNELTNSNKSHNKGTNIHKLPNIHTDYIKKLSPFVTKPTIVSGGLDGKIIVWDLNEL
KPIQLIENKANGVLSPSIYSLANNHSNIISTGGPNNTINIFDQRANNPFIRNLIGHQDNI
RCLLMNDQFILSGSSDTTIKLWDLRTFKVYKNFDIHDDSVWSLYSQSTSHDSFKTFYSGD
KSGNIIKTDLSRVSIFNTRTSNDDEFGFNNYENNYIDEKLGISTLIAKSTSPILSICHEP
EQDTIFATNMESMTRYINPDTCQLSQYQYLRQCLDYSYNTNNGIGVGNDNNDELLLHDGQ
SNPPTEDLNSDFYDLISHLSMDTHPNNNIDLQSTLSHGNNKQQHHNLFSDNTRPISLDAK
ASDIFTGDGFGDEQDDENISSREDFDSMFLNVNGGLSSEFINAFKDETNPLMVKLQTSNN
DDQHNNRNKTIDLTPIEILLNPIPIEQITLIPFNISPIEKYDLVPKSIVAKKMFNNRRQI
MVLYLNGNIKIWDLVIFKIVKIFPYQQQKQQQQQQQQQQEKEIRSSQKLLSSKELDNRIK
EMEDLFEQYQTSDTLNNWCEVEIKSGKLLVTIKESSYLNVEVYYDELISSYPFLDVNHSD
NLSRFTRKTKPNVSNDDRFYLGIIMLNSIFRGYALYEQEFDFILREELKNLKQSNNPIIP
SNGGNSKMLKYFGKKSSSLIKNSTSSNQSSPATSTNTSIVDVPIEKSTSNIGDNSNNGTS
SLYTIVNEFINTPEDVYENSVNFDYGDTIMKLLQINKKIYWDKYNVPVNMTKGKVLESIL
GVDEITTSISKTNKETNNGIADLRYYPIIRGDIHFPKDLLITIFEYSSDLGNYRDLFSFE
YQDLLNLSHHTNNNFNDSSTKNTITFNTSSSSSSFSFSSSSSLSYQLIQDLRLMVPKWIG
QPILFNKHPIKESPKITFQLTEVDYNQLPSYLKIGGKSNKKIKKLPELESSIKLTSHNML
RVSKILNYLVEKFANTTKEMKDKNLIPSDWLVLQCKGQELNNDLTLQTIKTKIWKSSSDI
ELQFRRKYDK
Download sequence
Identical sequences C4YG41
CAWT_00159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]