SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5CAJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C5CAJ9
Domain Number - Region: 39-107
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0102
Family Tubulin chaperone cofactor A 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5CAJ9
Sequence length 159
Comment (tr|C5CAJ9|C5CAJ9_MICLC) Uncharacterized protein {ECO:0000313|EMBL:ACS30903.1} KW=Complete proteome; Reference proteome OX=465515 OS=lysodeikticus). GN=Mlut_14030 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Micrococcus.
Sequence
MSLIRRRPAALSLATLAALALAASGCAVDDGETRAALQSAEDRLAQAEDRISELEADASD
RVDLGQLRQEAEDALAEADQRAAEVVEDLTRSLPSGSDIVDVEALREDGKVVIEYGQSLL
EADPQVLEETMREAAEQARNAIPDLKDVEFRVGDRTFTY
Download sequence
Identical sequences C5CAJ9
gi|239917899|ref|YP_002957457.1| 465515.Mlut_14030 WP_010078461.1.25715 WP_010078461.1.54265 WP_010078461.1.79382 WP_010078461.1.79589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]