SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5G838 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5G838
Domain Number 1 Region: 7-92
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 2.09e-19
Family Tubulin chaperone cofactor A 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5G838
Sequence length 120
Comment (tr|C5G838|C5G838_AJEDR) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=559297 OS=dermatitidis). GN=BDCG_00197 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Blastomyces.
Sequence
MAPLSPLSIATSAVRRLVKEEASYHRELKQQEERIKRLEAEQPGEDEDGNREFMLRQERQ
ALEETKKVLPNMKQKILEAIAKVDHLLVEEGQKGMGSNVDEINAAKEAISQAMTAVREVS
Download sequence
Identical sequences C5G838 T5C3H9
BDCG_00197T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]